Lineage for d2dzua_ (2dzu A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079565Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2079595Protein Trp synthase alpha-subunit [51388] (8 species)
  7. 2079613Species Pyrococcus furiosus [TaxId:2261] [51390] (10 PDB entries)
  8. 2079620Domain d2dzua_: 2dzu A: [163761]
    automated match to d1geqa_
    mutant

Details for d2dzua_

PDB Entry: 2dzu (more details), 2.46 Å

PDB Description: Structure of mutant tryptophan synthase alpha-subunit (D110N) from a hyperthermophile, Pyrococcus furiosus
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d2dzua_:

Sequence, based on SEQRES records: (download)

>d2dzua_ c.1.2.4 (A:) Trp synthase alpha-subunit {Pyrococcus furiosus [TaxId: 2261]}
mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvngilvvdlpvf
hakefteiareegiktvflaapntpderlkviddmttgfvylvslygttgareeipktay
dllrrakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkk
kveellgi

Sequence, based on observed residues (ATOM records): (download)

>d2dzua_ c.1.2.4 (A:) Trp synthase alpha-subunit {Pyrococcus furiosus [TaxId: 2261]}
mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvngilvvdlpvf
hakefteiareegiktvflaapntpderlkviddmttgfvylvslygteeipktaydllr
rakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkkkvee
llgi

SCOPe Domain Coordinates for d2dzua_:

Click to download the PDB-style file with coordinates for d2dzua_.
(The format of our PDB-style files is described here.)

Timeline for d2dzua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dzub_