Lineage for d1lrea_ (1lre A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725328Fold a.13: RAP domain-like [47044] (1 superfamily)
    3 helices, the first one is shorter than the other two; bundle, partly opened
  4. 1725329Superfamily a.13.1: RAP domain-like [47045] (1 family) (S)
  5. 1725330Family a.13.1.1: RAP domain [47046] (1 protein)
  6. 1725331Protein alpha-2-Macroglobulin receptor associated protein (RAP) [47047] (1 species)
  7. 1725332Species Human (Homo sapiens) [TaxId:9606] [47048] (7 PDB entries)
  8. 1725335Domain d1lrea_: 1lre A: [16376]

Details for d1lrea_

PDB Entry: 1lre (more details)

PDB Description: receptor associated protein (rap) domain 1, nmr, 20 structures
PDB Compounds: (A:) receptor-associated protein

SCOPe Domain Sequences for d1lrea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lrea_ a.13.1.1 (A:) alpha-2-Macroglobulin receptor associated protein (RAP) {Human (Homo sapiens) [TaxId: 9606]}
geefrmeklnqlwekaqrlhlppvrlaelhadlkiqerdelawkklkldgldedgekear
lirnlnvilakygldgkkdar

SCOPe Domain Coordinates for d1lrea_:

Click to download the PDB-style file with coordinates for d1lrea_.
(The format of our PDB-style files is described here.)

Timeline for d1lrea_: