Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) |
Protein Trp synthase alpha-subunit [51388] (9 species) |
Species Pyrococcus furiosus [TaxId:2261] [51390] (10 PDB entries) |
Domain d2dzpb_: 2dzp B: [163756] automated match to d1geqa_ mutant |
PDB Entry: 2dzp (more details), 2.4 Å
SCOPe Domain Sequences for d2dzpb_:
Sequence, based on SEQRES records: (download)
>d2dzpb_ c.1.2.4 (B:) Trp synthase alpha-subunit {Pyrococcus furiosus [TaxId: 2261]} mfkdgslipyltagdpnkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf hakefteiareegiktvflaapntpderlkviddmttgfvylvslygttgareeipktay dllrrakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkk kveellgi
>d2dzpb_ c.1.2.4 (B:) Trp synthase alpha-subunit {Pyrococcus furiosus [TaxId: 2261]} mfkdgslipyltagdpnkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf hakefteiareegiktvflaapntpderlkviddmttgfvylvslygtteeipktaydll rrakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkkkve ellgi
Timeline for d2dzpb_: