| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.12: Kix domain of CBP (creb binding protein) [47039] (1 superfamily) 3 helices; bundle, partly opened |
Superfamily a.12.1: Kix domain of CBP (creb binding protein) [47040] (1 family) ![]() automatically mapped to Pfam PF02172 |
| Family a.12.1.1: Kix domain of CBP (creb binding protein) [47041] (1 protein) |
| Protein Kix domain of CBP (creb binding protein) [47042] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [47043] (13 PDB entries) |
| Domain d1kdxa_: 1kdx A: [16375] |
PDB Entry: 1kdx (more details)
SCOPe Domain Sequences for d1kdxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kdxa_ a.12.1.1 (A:) Kix domain of CBP (creb binding protein) {Mouse (Mus musculus) [TaxId: 10090]}
gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans
rdeyyhllaekiykiqkelee
Timeline for d1kdxa_: