Lineage for d2dyyb_ (2dyy B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958620Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 2958704Protein automated matches [190254] (5 species)
    not a true protein
  7. 2958726Species Pyrococcus horikoshii [TaxId:53953] [187648] (1 PDB entry)
  8. 2958728Domain d2dyyb_: 2dyy B: [163744]
    automated match to d1x25a1

Details for d2dyyb_

PDB Entry: 2dyy (more details), 2.6 Å

PDB Description: Crystal structure of putative translation initiation inhibitor PH0854 from Pyrococcus horikoshii
PDB Compounds: (B:) UPF0076 protein PH0854

SCOPe Domain Sequences for d2dyyb_:

Sequence, based on SEQRES records: (download)

>d2dyyb_ d.79.1.1 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mkeviftenapkpigpysqaikagnflfiagqipidpktgeivkgdikdqtrqvlenika
ileaagyslndvikvtvylkdmndfakmnevyaeyfgeskparvavevsrlpkdvlieie
aiayke

Sequence, based on observed residues (ATOM records): (download)

>d2dyyb_ d.79.1.1 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mkeviftenapkpigpysqaikagnflfiagqipidpktgeivkgdikdqtrqvlenika
ileaagyslndvikvtvylkdnevyaeyfgeskparvavevsrlpkdvlieieaiayke

SCOPe Domain Coordinates for d2dyyb_:

Click to download the PDB-style file with coordinates for d2dyyb_.
(The format of our PDB-style files is described here.)

Timeline for d2dyyb_: