Lineage for d2dyca_ (2dyc A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781176Species Mouse (Mus musculus) [TaxId:10090] [187609] (10 PDB entries)
  8. 2781189Domain d2dyca_: 2dyc A: [163742]
    automated match to d1bkza_

Details for d2dyca_

PDB Entry: 2dyc (more details), 2.4 Å

PDB Description: Crystal structure of the N-terminal domain of mouse galectin-4
PDB Compounds: (A:) Galectin-4

SCOPe Domain Sequences for d2dyca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyca_ b.29.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ynptlpykrpipgglsvgmsvyiqgmakenmrrfhvnfavgqddgadvafhfnprfdgwd
kvvfntmqsgqwgkeekkksmpfqkgkhfelvfmvmpehykvvvngnsfyeyghrlpvqm
vthlqvdgdlelqsinflggqpaaapy

SCOPe Domain Coordinates for d2dyca_:

Click to download the PDB-style file with coordinates for d2dyca_.
(The format of our PDB-style files is described here.)

Timeline for d2dyca_: