Class a: All alpha proteins [46456] (226 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (1 family) |
Family a.11.2.1: Second domain of FERM [47032] (7 proteins) |
Protein Erythroid membrane protein 4.1R [47037] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47038] (1 PDB entry) |
Domain d1gg3c1: 1gg3 C:82-187 [16374] Other proteins in same PDB: d1gg3a2, d1gg3a3, d1gg3b2, d1gg3b3, d1gg3c2, d1gg3c3 |
PDB Entry: 1gg3 (more details), 2.8 Å
SCOP Domain Sequences for d1gg3c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gg3c1 a.11.2.1 (C:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens)} pdpaqlteditryylclqlrqdivagrlpcsfatlallgsytiqselgdydpelhgvdyv sdfklapnqtkeleekvmelhksyrsmtpaqadleflenakklsmy
Timeline for d1gg3c1: