Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (3 families) |
Family c.50.1.0: automated matches [191326] (1 protein) not a true family |
Protein automated matches [190146] (3 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [187646] (1 PDB entry) |
Domain d2dx6a_: 2dx6 A: [163733] automated match to d1spva_ complexed with act, ipa |
PDB Entry: 2dx6 (more details), 1.78 Å
SCOPe Domain Sequences for d2dx6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dx6a_ c.50.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]} arirvvqgditefqgdaivnaannylklgagvagailrkggpsiqeecdrigkirvgeaa vtgagnlpvryvihaavlgdepasletvrkatksalekavelglktvafpllgtgvgglp veavarvmleeikkapdtlevtlygyreedaeairral
Timeline for d2dx6a_: