Lineage for d2dx6a_ (2dx6 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 994079Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 994080Superfamily c.50.1: Macro domain-like [52949] (3 families) (S)
  5. 994158Family c.50.1.0: automated matches [191326] (1 protein)
    not a true family
  6. 994159Protein automated matches [190146] (3 species)
    not a true protein
  7. 994166Species Thermus thermophilus [TaxId:300852] [187646] (1 PDB entry)
  8. 994167Domain d2dx6a_: 2dx6 A: [163733]
    automated match to d1spva_
    complexed with act, ipa

Details for d2dx6a_

PDB Entry: 2dx6 (more details), 1.78 Å

PDB Description: Crystal structure of conserved hypothetical protein, TTHA0132 from Thermus thermophilus HB8
PDB Compounds: (A:) Hypothetical protein TTHA0132

SCOPe Domain Sequences for d2dx6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dx6a_ c.50.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
arirvvqgditefqgdaivnaannylklgagvagailrkggpsiqeecdrigkirvgeaa
vtgagnlpvryvihaavlgdepasletvrkatksalekavelglktvafpllgtgvgglp
veavarvmleeikkapdtlevtlygyreedaeairral

SCOPe Domain Coordinates for d2dx6a_:

Click to download the PDB-style file with coordinates for d2dx6a_.
(The format of our PDB-style files is described here.)

Timeline for d2dx6a_: