Lineage for d2dwzc_ (2dwz C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944478Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1944479Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1944480Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
  6. 1944572Protein automated matches [190101] (6 species)
    not a true protein
  7. 1944610Species Mouse (Mus musculus) [TaxId:10090] [187645] (3 PDB entries)
  8. 1944614Domain d2dwzc_: 2dwz C: [163732]
    automated match to d1tr4a_
    complexed with epe

Details for d2dwzc_

PDB Entry: 2dwz (more details), 2.4 Å

PDB Description: Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome
PDB Compounds: (C:) 26S proteasome non-ATPase regulatory subunit 10

SCOPe Domain Sequences for d2dwzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dwzc_ d.211.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cvsnimicnlaysgkldelkeriladkslatrtdqdsrtalhwacsaghteivefllqlg
vpvndkddagwsplhiaasagrdeivkallvkgahvnavnqngctplhyaasknrheiav
mllegganpdakdhydatamhraaakgnlkmvhillfykastniqdtegntplhlacdee
rveeakflvtqgasiyienkeektplqvakgglglilkrlaegeea

SCOPe Domain Coordinates for d2dwzc_:

Click to download the PDB-style file with coordinates for d2dwzc_.
(The format of our PDB-style files is described here.)

Timeline for d2dwzc_: