SCOPe 2.02: Domain d2dwzc_: 2dwz C:

Lineage for d2dwzc_ (2dwz C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187645] (2 PDB entries)

8. Domain d2dwzc_: 2dwz C: [163732]
   automated match to d1tr4a_
   complexed with epe

Details for d2dwzc_

PDB Entry: 2dwz, 2.4 Å

PDB Description: Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome

PDB Compounds: (C:) 26S proteasome non-ATPase regulatory subunit 10

SCOPe Domain Sequences for d2dwzc_:

Sequence; same for both SEQRES and ATOM records:

>d2dwzc_ d.211.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cvsnimicnlaysgkldelkeriladkslatrtdqdsrtalhwacsaghteivefllqlg
vpvndkddagwsplhiaasagrdeivkallvkgahvnavnqngctplhyaasknrheiav
mllegganpdakdhydatamhraaakgnlkmvhillfykastniqdtegntplhlacdee
rveeakflvtqgasiyienkeektplqvakgglglilkrlaegeea

Timeline for d2dwzc_:

• d2dwzc_ first appeared in SCOPe 2.01
  
• d2dwzc_ appears in SCOPe 2.03
  
• d2dwzc_ appears in the current release, SCOPe 2.08