Lineage for d2dwza_ (2dwz A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238947Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2238948Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2238949Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 2239041Protein automated matches [190101] (7 species)
    not a true protein
  7. 2239081Species Mouse (Mus musculus) [TaxId:10090] [187645] (3 PDB entries)
  8. 2239084Domain d2dwza_: 2dwz A: [163731]
    automated match to d1tr4a_
    complexed with epe

Details for d2dwza_

PDB Entry: 2dwz (more details), 2.4 Å

PDB Description: Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome
PDB Compounds: (A:) 26S proteasome non-ATPase regulatory subunit 10

SCOPe Domain Sequences for d2dwza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dwza_ d.211.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cvsnimicnlaysgkldelkeriladkslatrtdqdsrtalhwacsaghteivefllqlg
vpvndkddagwsplhiaasagrdeivkallvkgahvnavnqngctplhyaasknrheiav
mllegganpdakdhydatamhraaakgnlkmvhillfykastniqdtegntplhlacdee
rveeakflvtqgasiyienkeektplqvakgglglilkrlaegeea

SCOPe Domain Coordinates for d2dwza_:

Click to download the PDB-style file with coordinates for d2dwza_.
(The format of our PDB-style files is described here.)

Timeline for d2dwza_: