Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (19 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein automated matches [190101] (7 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187645] (3 PDB entries) |
Domain d2dwza_: 2dwz A: [163731] automated match to d1tr4a_ complexed with epe |
PDB Entry: 2dwz (more details), 2.4 Å
SCOPe Domain Sequences for d2dwza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dwza_ d.211.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} cvsnimicnlaysgkldelkeriladkslatrtdqdsrtalhwacsaghteivefllqlg vpvndkddagwsplhiaasagrdeivkallvkgahvnavnqngctplhyaasknrheiav mllegganpdakdhydatamhraaakgnlkmvhillfykastniqdtegntplhlacdee rveeakflvtqgasiyienkeektplqvakgglglilkrlaegeea
Timeline for d2dwza_: