Lineage for d2dvqc_ (2dvq C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2320183Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)
  8. 2320834Domain d2dvqc_: 2dvq C: [163721]
    automated match to d1jm4b_

Details for d2dvqc_

PDB Entry: 2dvq (more details), 2.04 Å

PDB Description: Crystal structure analysis of the N-terminal bromodomain of human BRD2 complexed with acetylated histone H4 peptide
PDB Compounds: (C:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d2dvqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dvqc_ a.29.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlennyy
waasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpq

SCOPe Domain Coordinates for d2dvqc_:

Click to download the PDB-style file with coordinates for d2dvqc_.
(The format of our PDB-style files is described here.)

Timeline for d2dvqc_: