SCOPe 2.04: Domain d2dvqb_: 2dvq B:

Lineage for d2dvqb_ (2dvq B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (182 PDB entries)

8. Domain d2dvqb_: 2dvq B: [163720]
   automated match to d1jm4b_

Details for d2dvqb_

PDB Entry: 2dvq, 2.04 Å

PDB Description: Crystal structure analysis of the N-terminal bromodomain of human BRD2 complexed with acetylated histone H4 peptide

PDB Compounds: (B:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d2dvqb_:

Sequence; same for both SEQRES and ATOM records:

>d2dvqb_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlen
nyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpqee

Timeline for d2dvqb_:

• d2dvqb_ first appeared in SCOPe 2.01
  
• d2dvqb_ appears in SCOPe 2.03
  
• d2dvqb_ appears in SCOPe 2.05
  
• d2dvqb_ appears in the current release, SCOPe 2.08