Lineage for d1gg3a1 (1gg3 A:82-187)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 439943Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 439958Superfamily a.11.2: Second domain of FERM [47031] (1 family) (S)
  5. 439959Family a.11.2.1: Second domain of FERM [47032] (6 proteins)
  6. 439960Protein Erythroid membrane protein 4.1R [47037] (1 species)
  7. 439961Species Human (Homo sapiens) [TaxId:9606] [47038] (1 PDB entry)
  8. 439962Domain d1gg3a1: 1gg3 A:82-187 [16372]
    Other proteins in same PDB: d1gg3a2, d1gg3a3, d1gg3b2, d1gg3b3, d1gg3c2, d1gg3c3

Details for d1gg3a1

PDB Entry: 1gg3 (more details), 2.8 Å

PDB Description: crystal structure of the protein 4.1r membrane binding domain

SCOP Domain Sequences for d1gg3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens)}
pdpaqlteditryylclqlrqdivagrlpcsfatlallgsytiqselgdydpelhgvdyv
sdfklapnqtkeleekvmelhksyrsmtpaqadleflenakklsmy

SCOP Domain Coordinates for d1gg3a1:

Click to download the PDB-style file with coordinates for d1gg3a1.
(The format of our PDB-style files is described here.)

Timeline for d1gg3a1: