SCOPe 2.06: Domain d2dvqa_: 2dvq A:

Lineage for d2dvqa_ (2dvq A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries)

8. Domain d2dvqa_: 2dvq A: [163719]
   automated match to d1jm4b_

Details for d2dvqa_

PDB Entry: 2dvq, 2.04 Å

PDB Description: Crystal structure analysis of the N-terminal bromodomain of human BRD2 complexed with acetylated histone H4 peptide

PDB Compounds: (A:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d2dvqa_:

Sequence; same for both SEQRES and ATOM records:

>d2dvqa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlen
nyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpqeeqe

Timeline for d2dvqa_:

• d2dvqa_ first appeared in SCOPe 2.01
  
• d2dvqa_ appears in SCOPe 2.05
  
• d2dvqa_ appears in SCOPe 2.07
  
• d2dvqa_ appears in the current release, SCOPe 2.08