Lineage for d2dumd_ (2dum D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2119957Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2120231Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2120232Protein automated matches [190116] (24 species)
    not a true protein
  7. 2120314Species Pyrococcus horikoshii OT3 [TaxId:70601] [311263] (4 PDB entries)
  8. 2120324Domain d2dumd_: 2dum D: [163710]
    automated match to d1mjha_

Details for d2dumd_

PDB Entry: 2dum (more details), 2.75 Å

PDB Description: Crystal structure of hypothetical protein, PH0823
PDB Compounds: (D:) Hypothetical protein PH0823

SCOPe Domain Sequences for d2dumd_:

Sequence, based on SEQRES records: (download)

>d2dumd_ c.26.2.0 (D:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mfrkvlfptdfsegayravevfekrnkmevgevillhvidegtleelmdgysffydnaei
elkdikeklkeeasrklqekaeevkrafraknvrtiirfgipwdeivkvaeeenvsliil
psrgklslsheflgstvmrvlrktkkpvliikevde

Sequence, based on observed residues (ATOM records): (download)

>d2dumd_ c.26.2.0 (D:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mfrkvlfptdfsegayravevfekrnkmevgevillhvidegtleelmdglkdikeklke
easrklqekaeevkrafraknvrtiirfgipwdeivkvaeeenvsliilpsrgkheflgs
tvmrvlrktkkpvliikevde

SCOPe Domain Coordinates for d2dumd_:

Click to download the PDB-style file with coordinates for d2dumd_.
(The format of our PDB-style files is described here.)

Timeline for d2dumd_: