SCOPe 2.05: Domain d2dumd_: 2dum D:

Lineage for d2dumd_ (2dum D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (18 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [187637] (3 PDB entries)

8. Domain d2dumd_: 2dum D: [163710]
   automated match to d1mjha_

Details for d2dumd_

PDB Entry: 2dum, 2.75 Å

PDB Description: Crystal structure of hypothetical protein, PH0823

PDB Compounds: (D:) Hypothetical protein PH0823

SCOPe Domain Sequences for d2dumd_:

Sequence, based on SEQRES records:

>d2dumd_ c.26.2.0 (D:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mfrkvlfptdfsegayravevfekrnkmevgevillhvidegtleelmdgysffydnaei
elkdikeklkeeasrklqekaeevkrafraknvrtiirfgipwdeivkvaeeenvsliil
psrgklslsheflgstvmrvlrktkkpvliikevde

Sequence, based on observed residues (ATOM records):

>d2dumd_ c.26.2.0 (D:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mfrkvlfptdfsegayravevfekrnkmevgevillhvidegtleelmdglkdikeklke
easrklqekaeevkrafraknvrtiirfgipwdeivkvaeeenvsliilpsrgkheflgs
tvmrvlrktkkpvliikevde

Timeline for d2dumd_:

• d2dumd_ first appeared in SCOPe 2.01
  
• d2dumd_ appears in SCOPe 2.04
  
• d2dumd_ appears in SCOPe 2.06
  
• d2dumd_ appears in the current release, SCOPe 2.08