SCOP 1.67: Domain d1gc6a1: 1gc6 A:88-198

Lineage for d1gc6a1 (1gc6 A:88-198)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (1 family)

5. Family a.11.2.1: Second domain of FERM [47032] (6 proteins)

6. Protein Radixin [47035] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47036] (3 PDB entries)

8. Domain d1gc6a1: 1gc6 A:88-198 [16371]
   Other proteins in same PDB: d1gc6a2, d1gc6a3
   complexed with i3p

Details for d1gc6a1

PDB Entry: 1gc6, 2.9 Å

PDB Description: crystal structure of the radixin ferm domain complexed with inositol-(1,4,5)-triphosphate

SCOP Domain Sequences for d1gc6a1:

Sequence; same for both SEQRES and ATOM records:

>d1gc6a1 a.11.2.1 (A:88-198) Radixin {Mouse (Mus musculus)}
dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl
andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl

Timeline for d1gc6a1:

• d1gc6a1 first appeared (with stable ids) in SCOP 1.55
  
• d1gc6a1 appears in SCOP 1.65
  
• d1gc6a1 appears in SCOP 1.69
  
• d1gc6a1 appears in the current release, SCOPe 2.08