Lineage for d2dumb_ (2dum B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 984755Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 985339Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 985589Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 985590Protein automated matches [190116] (8 species)
    not a true protein
  7. 985618Species Pyrococcus horikoshii [TaxId:70601] [187637] (2 PDB entries)
  8. 985622Domain d2dumb_: 2dum B: [163708]
    automated match to d1mjha_

Details for d2dumb_

PDB Entry: 2dum (more details), 2.75 Å

PDB Description: Crystal structure of hypothetical protein, PH0823
PDB Compounds: (B:) Hypothetical protein PH0823

SCOPe Domain Sequences for d2dumb_:

Sequence, based on SEQRES records: (download)

>d2dumb_ c.26.2.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mfrkvlfptdfsegayravevfekrnkmevgevillhvidegtleelmdgysffydnaei
elkdikeklkeeasrklqekaeevkrafraknvrtiirfgipwdeivkvaeeenvsliil
psrgklslsheflgstvmrvlrktkkpvliikevde

Sequence, based on observed residues (ATOM records): (download)

>d2dumb_ c.26.2.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mfrkvlfptdfsegayravevfekrnkmevgevillhvidegtleelmdgykdikeklke
easrklqekaeevkrafraknvrtiirfgipwdeivkvaeeenvsliilpsrheflgstv
mrvlrktkkpvliikevde

SCOPe Domain Coordinates for d2dumb_:

Click to download the PDB-style file with coordinates for d2dumb_.
(The format of our PDB-style files is described here.)

Timeline for d2dumb_: