Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
Protein automated matches [190116] (8 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:70601] [187637] (2 PDB entries) |
Domain d2dumb_: 2dum B: [163708] automated match to d1mjha_ |
PDB Entry: 2dum (more details), 2.75 Å
SCOPe Domain Sequences for d2dumb_:
Sequence, based on SEQRES records: (download)
>d2dumb_ c.26.2.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]} mfrkvlfptdfsegayravevfekrnkmevgevillhvidegtleelmdgysffydnaei elkdikeklkeeasrklqekaeevkrafraknvrtiirfgipwdeivkvaeeenvsliil psrgklslsheflgstvmrvlrktkkpvliikevde
>d2dumb_ c.26.2.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]} mfrkvlfptdfsegayravevfekrnkmevgevillhvidegtleelmdgykdikeklke easrklqekaeevkrafraknvrtiirfgipwdeivkvaeeenvsliilpsrheflgstv mrvlrktkkpvliikevde
Timeline for d2dumb_: