| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
| Protein automated matches [190116] (28 species) not a true protein |
| Species Pyrococcus horikoshii OT3 [TaxId:70601] [311263] (4 PDB entries) |
| Domain d2duma_: 2dum A: [163707] automated match to d1mjha_ |
PDB Entry: 2dum (more details), 2.75 Å
SCOPe Domain Sequences for d2duma_:
Sequence, based on SEQRES records: (download)
>d2duma_ c.26.2.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mfrkvlfptdfsegayravevfekrnkmevgevillhvidegtleelmdgysffydnaei
elkdikeklkeeasrklqekaeevkrafraknvrtiirfgipwdeivkvaeeenvsliil
psrgklslsheflgstvmrvlrktkkpvliikevden
>d2duma_ c.26.2.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mfrkvlfptdfsegayravevfekrnkmevgevillhvidegtleelmelkdikeklkee
asrklqekaeevkrafraknvrtiirfgipwdeivkvaeeenvsliilpsrgklsheflg
stvmrvlrktkkpvliikevden
Timeline for d2duma_: