Lineage for d1gc7a1 (1gc7 A:88-198)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534842Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 534857Superfamily a.11.2: Second domain of FERM [47031] (1 family) (S)
  5. 534858Family a.11.2.1: Second domain of FERM [47032] (7 proteins)
  6. 534880Protein Radixin [47035] (1 species)
  7. 534881Species Mouse (Mus musculus) [TaxId:10090] [47036] (3 PDB entries)
  8. 534883Domain d1gc7a1: 1gc7 A:88-198 [16370]
    Other proteins in same PDB: d1gc7a2, d1gc7a3

Details for d1gc7a1

PDB Entry: 1gc7 (more details), 2.8 Å

PDB Description: crystal structure of the radixin ferm domain

SCOP Domain Sequences for d1gc7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gc7a1 a.11.2.1 (A:88-198) Radixin {Mouse (Mus musculus)}
dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl
andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl

SCOP Domain Coordinates for d1gc7a1:

Click to download the PDB-style file with coordinates for d1gc7a1.
(The format of our PDB-style files is described here.)

Timeline for d1gc7a1: