Lineage for d2duaa_ (2dua A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088358Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 2088359Protein automated matches [190614] (15 species)
    not a true protein
  7. 2088427Species Variovorax sp. [TaxId:218557] [187638] (3 PDB entries)
  8. 2088429Domain d2duaa_: 2dua A: [163699]
    automated match to d1s2vb_
    complexed with cl, mg, na, oxl, xys

Details for d2duaa_

PDB Entry: 2dua (more details), 2 Å

PDB Description: crystal structure of phosphonopyruvate hydrolase complex with oxalate and mg++
PDB Compounds: (A:) Phosphonopyruvate hydrolase

SCOPe Domain Sequences for d2duaa_:

Sequence, based on SEQRES records: (download)

>d2duaa_ c.1.12.0 (A:) automated matches {Variovorax sp. [TaxId: 218557]}
mtknqalraaldsgrlftamaahnplvaklaeqagfggiwgsgfelsasyavpdanilsm
sthlemmraiastvsipliadidtgfgnavnvhyvvpqyeaagasaivmedktfpkdtsl
rtdgrqelvrieefqgkiaaataaradrdfvviarvealiaglgqqeavrrgqayeeaga
dailihsrqktpdeilafvkswpgkvplvlvptaypqlteadiaalskvgiviygnhair
aavgavrevfarirrdggirevdaalpsvkeiielqgdermravearylk

Sequence, based on observed residues (ATOM records): (download)

>d2duaa_ c.1.12.0 (A:) automated matches {Variovorax sp. [TaxId: 218557]}
mtknqalraaldsgrlftamaahnplvaklaeqagfggiwgsgfelsasyavpdanilsm
sthlemmraiastvsipliadidtgfgnavnvhyvvpqyeaagasaivmedktfpkdtqe
lvrieefqgkiaaataaradrdfvviarvealiaglgqqeavrrgqayeeagadailihs
rqktpdeilafvkswpgkvplvlvptaypqlteadiaalskvgiviygnhairaavgavr
evfarirrdggirevdaalpsvkeiielqgdermravearylk

SCOPe Domain Coordinates for d2duaa_:

Click to download the PDB-style file with coordinates for d2duaa_.
(The format of our PDB-style files is described here.)

Timeline for d2duaa_: