SCOPe 2.05: Domain d2du2c_: 2du2 C:

Lineage for d2du2c_ (2du2 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.0: automated matches [191310] (1 protein)
   not a true family

6. Protein automated matches [190048] (17 species)
   not a true protein

7. Species Aerococcus viridans [TaxId:1377] [187639] (7 PDB entries)

8. Domain d2du2c_: 2du2 C: [163697]
   automated match to d1tb3a1
   complexed with fmn

Details for d2du2c_

PDB Entry: 2du2, 2.1 Å

PDB Description: Crystal Structure Analysis of the L-Lactate Oxidase

PDB Compounds: (C:) Lactate oxidase

SCOPe Domain Sequences for d2du2c_:

Sequence; same for both SEQRES and ATOM records:

>d2du2c_ c.1.4.0 (C:) automated matches {Aerococcus viridans [TaxId: 1377]}
mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaghsglpvfv
kgiqhpedadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
kgldlfdnpygyey

Timeline for d2du2c_:

• d2du2c_ first appeared in SCOPe 2.01
  
• d2du2c_ appears in SCOPe 2.04
  
• d2du2c_ appears in SCOPe 2.06
  
• d2du2c_ appears in the current release, SCOPe 2.08