SCOPe 2.05: Domain d2dtna_: 2dtn A:

Lineage for d2dtna_ (2dtn A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.0: automated matches [191361] (1 protein)
   not a true family

6. Protein automated matches [190431] (4 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [187325] (2 PDB entries)

8. Domain d2dtna_: 2dtn A: [163691]
   automated match to d1uehb_
   complexed with dpo

Details for d2dtna_

PDB Entry: 2dtn, 2.5 Å

PDB Description: Crystal structure of Helicobacter pylori undecaprenyl pyrophosphate synthase complexed with pyrophosphate

PDB Compounds: (A:) undecaprenyl pyrophosphate synthase

SCOPe Domain Sequences for d2dtna_:

Sequence, based on SEQRES records:

>d2dtna_ c.101.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
stlkhlaiimdgngrwaklknkarayghkkgvktlkditiwcanhklecltlyafstenw
krpksevdflmkmlkkylkderstyldnnirfraigdlegfskelrdtilqlendtrhfk
dftqvlalnygsknelsrafksllesppsnisllesleneisnrldtrnlpevdlllrtg
gemrlsnfllwqssyaelfftpilwpdftpkdleniisdfykrv

Sequence, based on observed residues (ATOM records):

>d2dtna_ c.101.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
stlkhlaiimdgngrwaklknkarayghkkgvktlkditiwcanhklecltlyafevdfl
mkmlkkylkderstyldnnirfraigdlegfskelrdtilqlendtrhfkdftqvlalny
gsknelsrafksllesppsnisllesleneisnrldtrnlpevdlllrtggemrlsnfll
wqssyaelfftpilwpdftpkdleniisdfykrv

Timeline for d2dtna_:

• d2dtna_ first appeared in SCOPe 2.01
  
• d2dtna_ appears in SCOPe 2.04
  
• d2dtna_ appears in SCOPe 2.06
  
• d2dtna_ appears in the current release, SCOPe 2.08