Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156 |
Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase |
Family c.101.1.0: automated matches [191361] (1 protein) not a true family |
Protein automated matches [190431] (4 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [187325] (2 PDB entries) |
Domain d2dtna_: 2dtn A: [163691] automated match to d1uehb_ complexed with dpo |
PDB Entry: 2dtn (more details), 2.5 Å
SCOPe Domain Sequences for d2dtna_:
Sequence, based on SEQRES records: (download)
>d2dtna_ c.101.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]} stlkhlaiimdgngrwaklknkarayghkkgvktlkditiwcanhklecltlyafstenw krpksevdflmkmlkkylkderstyldnnirfraigdlegfskelrdtilqlendtrhfk dftqvlalnygsknelsrafksllesppsnisllesleneisnrldtrnlpevdlllrtg gemrlsnfllwqssyaelfftpilwpdftpkdleniisdfykrv
>d2dtna_ c.101.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]} stlkhlaiimdgngrwaklknkarayghkkgvktlkditiwcanhklecltlyafevdfl mkmlkkylkderstyldnnirfraigdlegfskelrdtilqlendtrhfkdftqvlalny gsknelsrafksllesppsnisllesleneisnrldtrnlpevdlllrtggemrlsnfll wqssyaelfftpilwpdftpkdleniisdfykrv
Timeline for d2dtna_: