Lineage for d2dteb1 (2dte B:2-255)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848817Species Thermoplasma acidophilum [TaxId:2303] [187636] (6 PDB entries)
  8. 2848819Domain d2dteb1: 2dte B:2-255 [163690]
    Other proteins in same PDB: d2dtea2, d2dteb2
    automated match to d2d1ya1
    complexed with nai

Details for d2dteb1

PDB Entry: 2dte (more details), 1.65 Å

PDB Description: Structure of Thermoplasma acidophilum aldohexose dehydrogenase (AldT) in complex with NADH
PDB Compounds: (B:) Glucose 1-dehydrogenase related protein

SCOPe Domain Sequences for d2dteb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dteb1 c.2.1.0 (B:2-255) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
fsdlrdkvvivtgasmgigraiaerfvdegskvidlsihdpgeakydhiecdvtnpdqvk
asidhifkeygsisvlvnnagiesygkiesmsmgewrriidvnlfgyyyaskfaipymir
srdpsivnissvqasiitknasayvtskhavigltksialdyapllrcnavcpatidtpl
vrkaaelevgsdpmriekkisewghehpmqrigkpqevasavaflasreasfitgtclyv
dgglsirapistpe

SCOPe Domain Coordinates for d2dteb1:

Click to download the PDB-style file with coordinates for d2dteb1.
(The format of our PDB-style files is described here.)

Timeline for d2dteb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dteb2