SCOPe 2.08: Domain d2dteb1: 2dte B:2-255

Lineage for d2dteb1 (2dte B:2-255)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Thermoplasma acidophilum [TaxId:2303] [187636] (6 PDB entries)

8. Domain d2dteb1: 2dte B:2-255 [163690]
   Other proteins in same PDB: d2dtea2, d2dteb2
   automated match to d2d1ya1
   complexed with nai

Details for d2dteb1

PDB Entry: 2dte, 1.65 Å

PDB Description: Structure of Thermoplasma acidophilum aldohexose dehydrogenase (AldT) in complex with NADH

PDB Compounds: (B:) Glucose 1-dehydrogenase related protein

SCOPe Domain Sequences for d2dteb1:

Sequence; same for both SEQRES and ATOM records:

>d2dteb1 c.2.1.0 (B:2-255) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
fsdlrdkvvivtgasmgigraiaerfvdegskvidlsihdpgeakydhiecdvtnpdqvk
asidhifkeygsisvlvnnagiesygkiesmsmgewrriidvnlfgyyyaskfaipymir
srdpsivnissvqasiitknasayvtskhavigltksialdyapllrcnavcpatidtpl
vrkaaelevgsdpmriekkisewghehpmqrigkpqevasavaflasreasfitgtclyv
dgglsirapistpe

Timeline for d2dteb1:

• d2dteb1 first appeared in SCOPe 2.01, called d2dteb_
  
• d2dteb1 appears in SCOPe 2.07