SCOP 1.59: Domain d1ef1b1: 1ef1 B:88-198

Lineage for d1ef1b1 (1ef1 B:88-198)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)

4. Superfamily a.11.2: Second domain of FERM [47031] (1 family)

5. Family a.11.2.1: Second domain of FERM [47032] (4 proteins)

6. Protein Moesin [47033] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47034] (2 PDB entries)

8. Domain d1ef1b1: 1ef1 B:88-198 [16369]
   Other proteins in same PDB: d1ef1a2, d1ef1a3, d1ef1b2, d1ef1b3, d1ef1c_, d1ef1d_

Details for d1ef1b1

PDB Entry: 1ef1, 1.9 Å

PDB Description: crystal structure of the moesin ferm domain/tail domain complex

SCOP Domain Sequences for d1ef1b1:

Sequence; same for both SEQRES and ATOM records:

>d1ef1b1 a.11.2.1 (B:88-198) Moesin {Human (Homo sapiens)}
dvseeliqditqrlfflqvkegilnddiycppetavllasyavqskygdfnkevhksgyl
agdkllpqrvleqhklnkdqweeriqvwheehrgmlredavleylkiaqdl

Timeline for d1ef1b1:

• d1ef1b1 first appeared (with stable ids) in SCOP 1.55
  
• d1ef1b1 appears in SCOP 1.57
  
• d1ef1b1 appears in SCOP 1.61
  
• d1ef1b1 appears in the current release, SCOPe 2.08