| Class a: All alpha proteins [46456] (144 folds) |
| Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) |
Superfamily a.11.2: Second domain of FERM [47031] (1 family) ![]() |
| Family a.11.2.1: Second domain of FERM [47032] (3 proteins) |
| Protein Moesin [47033] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47034] (2 PDB entries) |
| Domain d1ef1b1: 1ef1 B:88-198 [16369] Other proteins in same PDB: d1ef1a2, d1ef1a3, d1ef1b2, d1ef1b3, d1ef1c_, d1ef1d_ |
PDB Entry: 1ef1 (more details), 1.9 Å
SCOP Domain Sequences for d1ef1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ef1b1 a.11.2.1 (B:88-198) Moesin {Human (Homo sapiens)}
dvseeliqditqrlfflqvkegilnddiycppetavllasyavqskygdfnkevhksgyl
agdkllpqrvleqhklnkdqweeriqvwheehrgmlredavleylkiaqdl
Timeline for d1ef1b1: