SCOPe 2.06: Domain d2dtda1: 2dtd A:2-255

Lineage for d2dtda1 (2dtd A:2-255)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Thermoplasma acidophilum [TaxId:2303] [187636] (6 PDB entries)

8. Domain d2dtda1: 2dtd A:2-255 [163687]
   Other proteins in same PDB: d2dtda2, d2dtdb2
   automated match to d2d1ya1
   complexed with so4

Details for d2dtda1

PDB Entry: 2dtd, 2.1 Å

PDB Description: Structure of Thermoplasma acidophilum aldohexose dehydrogenase (AldT) in ligand-free form

PDB Compounds: (A:) Glucose 1-dehydrogenase related protein

SCOPe Domain Sequences for d2dtda1:

Sequence; same for both SEQRES and ATOM records:

>d2dtda1 c.2.1.0 (A:2-255) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
fsdlrdkvvivtgasmgigraiaerfvdegskvidlsihdpgeakydhiecdvtnpdqvk
asidhifkeygsisvlvnnagiesygkiesmsmgewrriidvnlfgyyyaskfaipymir
srdpsivnissvqasiitknasayvtskhavigltksialdyapllrcnavcpatidtpl
vrkaaelevgsdpmriekkisewghehpmqrigkpqevasavaflasreasfitgtclyv
dgglsirapistpe

Timeline for d2dtda1:

• d2dtda1 first appeared in SCOPe 2.01, called d2dtda_
  
• d2dtda1 was called d2dtda_ in SCOPe 2.05
  
• d2dtda1 appears in SCOPe 2.07
  
• d2dtda1 appears in the current release, SCOPe 2.08