SCOPe 2.01: Domain d2dsna_: 2dsn A:

Lineage for d2dsna_ (2dsn A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
   lack the first two strands of the common fold

6. Protein automated matches [190277] (5 species)
   not a true protein

7. Species Geobacillus zalihae [TaxId:213419] [187349] (2 PDB entries)

8. Domain d2dsna_: 2dsn A: [163683]
   automated match to d1ji3a_
   complexed with ca, cl, na, zn

Details for d2dsna_

PDB Entry: 2dsn, 1.5 Å

PDB Description: Crystal structure of T1 lipase

PDB Compounds: (A:) Thermostable lipase

SCOPe Domain Sequences for d2dsna_:

Sequence; same for both SEQRES and ATOM records:

>d2dsna_ c.69.1.18 (A:) automated matches {Geobacillus zalihae [TaxId: 213419]}
slrandapivllhgftgwgreemfgfkywggvrgdieqwlndngyrtytlavgplssnwd
raceayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrihiiahsqggqtarm
lvsllengsqeereyakahnvslsplfegghhfvlsvttiatphdgttlvnmvdftdrff
dlqkavleaaavasnvpytsqvydfkldqwglrrqpgesfdhyferlkrspvwtstdtar
ydlsvsgaeklnqwvqaspntyylsfstertyrgaltgnhypelgmnafsavvcapflgs
yrnptlgiddrwlendgivntvsmngpkrgssdrivpydgtlkkgvwndmgtynvdhlei
igvdpnpsfdirafylrlaeqlaslqp

Timeline for d2dsna_:

• d2dsna_ is new in SCOPe 2.01-stable
  
• d2dsna_ appears in SCOPe 2.02
  
• d2dsna_ appears in the current release, SCOPe 2.08