SCOPe 2.07: Domain d2dslb_: 2dsl B:

Lineage for d2dslb_ (2dsl B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)

6. Protein automated matches [190102] (7 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [186824] (5 PDB entries)

8. Domain d2dslb_: 2dsl B: [163682]
   automated match to d1j1ya_
   complexed with cl, mg; mutant

Details for d2dslb_

PDB Entry: 2dsl, 1.7 Å

PDB Description: mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8

PDB Compounds: (B:) Phenylacetic acid degradation protein paaI

SCOPe Domain Sequences for d2dslb_:

Sequence; same for both SEQRES and ATOM records:

>d2dslb_ d.38.1.5 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dpfmealglkvlhlapgeavvagevradhldlhgtahggflyaladsafalasntrgpav
alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl

Timeline for d2dslb_:

• d2dslb_ first appeared in SCOPe 2.01
  
• d2dslb_ appears in SCOPe 2.06
  
• d2dslb_ appears in the current release, SCOPe 2.08