Lineage for d2dsla_ (2dsl A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943854Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2943965Protein automated matches [190102] (7 species)
    not a true protein
  7. 2944023Species Thermus thermophilus HB8 [TaxId:300852] [186824] (5 PDB entries)
  8. 2944025Domain d2dsla_: 2dsl A: [163681]
    automated match to d1j1ya_
    complexed with cl, mg; mutant

Details for d2dsla_

PDB Entry: 2dsl (more details), 1.7 Å

PDB Description: mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8
PDB Compounds: (A:) Phenylacetic acid degradation protein paaI

SCOPe Domain Sequences for d2dsla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dsla_ d.38.1.5 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dpfmealglkvlhlapgeavvagevradhldlhgtahggflyaladsafalasntrgpav
alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl

SCOPe Domain Coordinates for d2dsla_:

Click to download the PDB-style file with coordinates for d2dsla_.
(The format of our PDB-style files is described here.)

Timeline for d2dsla_: