Lineage for d1ef1a1 (1ef1 A:88-198)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46140Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
  4. 46149Superfamily a.11.2: Second domain of FERM [47031] (1 family) (S)
  5. 46150Family a.11.2.1: Second domain of FERM [47032] (3 proteins)
  6. 46156Protein Moesin [47033] (1 species)
  7. 46157Species Human (Homo sapiens) [TaxId:9606] [47034] (2 PDB entries)
  8. 46158Domain d1ef1a1: 1ef1 A:88-198 [16368]
    Other proteins in same PDB: d1ef1a2, d1ef1a3, d1ef1b2, d1ef1b3, d1ef1c_, d1ef1d_

Details for d1ef1a1

PDB Entry: 1ef1 (more details), 1.9 Å

PDB Description: crystal structure of the moesin ferm domain/tail domain complex

SCOP Domain Sequences for d1ef1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens)}
dvseeliqditqrlfflqvkegilnddiycppetavllasyavqskygdfnkevhksgyl
agdkllpqrvleqhklnkdqweeriqvwheehrgmlredavleylkiaqdl

SCOP Domain Coordinates for d1ef1a1:

Click to download the PDB-style file with coordinates for d1ef1a1.
(The format of our PDB-style files is described here.)

Timeline for d1ef1a1: