![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
![]() | Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) ![]() |
![]() | Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins) Pfam PF00590 |
![]() | Protein Diphthine synthase, DphB [102684] (3 species) diphthamide biosynthesis methyltransferase |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [142779] (80 PDB entries) Uniprot O58456 1-265 |
![]() | Domain d2dsia_: 2dsi A: [163679] automated match to d1vcea1 complexed with gol, mes, sah, so4; mutant |
PDB Entry: 2dsi (more details), 2.2 Å
SCOPe Domain Sequences for d2dsia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dsia_ c.90.1.1 (A:) Diphthine synthase, DphB {Pyrococcus horikoshii [TaxId: 53953]} mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr edvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikarkrmymtane amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg klhiveaeylveiagapreilrvnv
Timeline for d2dsia_: