SCOPe 2.05: Domain d2ds0b_: 2ds0 B:

Lineage for d2ds0b_ (2ds0 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein automated matches [190608] (3 species)
   not a true protein

7. Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [187630] (3 PDB entries)

8. Domain d2ds0b_: 2ds0 B: [163673]
   automated match to d2zqna1
   complexed with so4; mutant

Details for d2ds0b_

PDB Entry: 2ds0, 1.8 Å

PDB Description: crystal structure of the earthworm lectin c-terminal domain mutant in complex with 6'-sialyllactose

PDB Compounds: (B:) 29-kDa galactose-binding lectin

SCOPe Domain Sequences for d2ds0b_:

Sequence; same for both SEQRES and ATOM records:

>d2ds0b_ b.42.2.1 (B:) automated matches {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
pkffyikselngkvldiggqnpapgskiitwdqkkgptavnqlwytdqqgvirsklndfa
idasheqietqpfdpnnpkrawivsgntiaqlsdrdnvlgviksdkgasahicawkqhgg
pnqkfiiese

Timeline for d2ds0b_:

• d2ds0b_ first appeared in SCOPe 2.01
  
• d2ds0b_ appears in SCOPe 2.04
  
• d2ds0b_ appears in SCOPe 2.06
  
• d2ds0b_ appears in the current release, SCOPe 2.08