SCOPe 2.08: Domain d2drza_: 2drz A:

Lineage for d2drza_ (2drz A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein automated matches [190608] (4 species)
   not a true protein

7. Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [187630] (3 PDB entries)

8. Domain d2drza_: 2drz A: [163670]
   automated match to d2zqna1
   complexed with so4; mutant

Details for d2drza_

PDB Entry: 2drz, 2.19 Å

PDB Description: crystal structure of the earthworm lectin c-terminal domain mutant in complex with lactose

PDB Compounds: (A:) 29-kDa galactose-binding lectin

SCOPe Domain Sequences for d2drza_:

Sequence; same for both SEQRES and ATOM records:

>d2drza_ b.42.2.1 (A:) automated matches {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
pkffyikselngkvldiggqnpapgskiitwdqkkgptavnqlwytdqqgvirsklndfa
idasheqietqpfdpnnpkrawivsgntiaqlsdrdnvlgviksdkgasahicawkqhgg
pnqkfiiese

Timeline for d2drza_:

• d2drza_ first appeared in SCOPe 2.01
  
• d2drza_ appears in SCOPe 2.07