Lineage for d2drza_ (2drz A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385272Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2385273Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2385440Protein automated matches [190608] (4 species)
    not a true protein
  7. 2385470Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [187630] (3 PDB entries)
  8. 2385475Domain d2drza_: 2drz A: [163670]
    automated match to d2zqna1
    complexed with so4; mutant

Details for d2drza_

PDB Entry: 2drz (more details), 2.19 Å

PDB Description: Crystal structure of the earthworm lectin C-terminal domain mutant in complex with lactose
PDB Compounds: (A:) 29-kDa galactose-binding lectin

SCOPe Domain Sequences for d2drza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2drza_ b.42.2.1 (A:) automated matches {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
pkffyikselngkvldiggqnpapgskiitwdqkkgptavnqlwytdqqgvirsklndfa
idasheqietqpfdpnnpkrawivsgntiaqlsdrdnvlgviksdkgasahicawkqhgg
pnqkfiiese

SCOPe Domain Coordinates for d2drza_:

Click to download the PDB-style file with coordinates for d2drza_.
(The format of our PDB-style files is described here.)

Timeline for d2drza_: