Lineage for d1acaa_ (1aca A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697427Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) (S)
  5. 2697428Family a.11.1.1: Acyl-CoA binding protein [47028] (2 proteins)
    automatically mapped to Pfam PF00887
  6. 2697429Protein Acyl-CoA binding protein [47029] (2 species)
  7. 2697430Species Cow (Bos taurus) [TaxId:9913] [47030] (6 PDB entries)
    Uniprot P07107
  8. 2697437Domain d1acaa_: 1aca A: [16367]
    complexed with coa, plm

Details for d1acaa_

PDB Entry: 1aca (more details)

PDB Description: three-dimensional structure of the complex between acyl-coenzyme a binding protein and palmitoyl-coenzyme a
PDB Compounds: (A:) acyl-coenzyme a binding protein

SCOPe Domain Sequences for d1acaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1acaa_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]}
sqaefdkaaeevkhlktkpadeemlfiyshykqatvgdinterpgmldfkgkakwdawne
lkgtskedamkayidkveelkkkygi

SCOPe Domain Coordinates for d1acaa_:

Click to download the PDB-style file with coordinates for d1acaa_.
(The format of our PDB-style files is described here.)

Timeline for d1acaa_: