![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
![]() | Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
![]() | Protein automated matches [190608] (4 species) not a true protein |
![]() | Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [187630] (3 PDB entries) |
![]() | Domain d2dryb_: 2dry B: [163669] automated match to d2zqna1 complexed with pge, so4; mutant |
PDB Entry: 2dry (more details), 1.8 Å
SCOPe Domain Sequences for d2dryb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dryb_ b.42.2.1 (B:) automated matches {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} pkffyikselngkvldiggqnpapgskiitwdqkkgptavnqlwytdqqgvirsklndfa idasheqietqpfdpnnpkrawivsgntiaqlsdrdnvlgviksdkgasahicawkqhgg pnqkfiiese
Timeline for d2dryb_: