Lineage for d2droa_ (2dro A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722054Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)
  6. 2722140Protein Xylanase Y [140784] (1 species)
  7. 2722141Species Bacillus halodurans [TaxId:86665] [140785] (7 PDB entries)
    Uniprot Q9KB30 6-381
  8. 2722145Domain d2droa_: 2dro A: [163664]
    automated match to d1wu4a1
    complexed with gol, ni; mutant

Details for d2droa_

PDB Entry: 2dro (more details), 1.7 Å

PDB Description: crystal structure of reducing-end-xylose releasing exo-oligoxylanase d263c mutant
PDB Compounds: (A:) Xylanase Y

SCOPe Domain Sequences for d2droa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2droa_ a.102.1.2 (A:) Xylanase Y {Bacillus halodurans [TaxId: 86665]}
egafytreyrnlfkefgyseaeiqervkdtweqlfgdnpetkiyyevgddlgylldtgnl
dvrtegmsygmmmavqmdrkdifdriwnwtmknmymtegvhagyfawscqpdgtknswgp
apdgeeyfalalffashrwgdgdeqpfnyseqarkllhtcvhngeggpghpmwnrdnkli
kfipevefsdpsyhlphfyelfslwaneedrvfwkeaaeasreylkiachpetglapeya
yydgtpndekgyghffscsyrvaanigldaewfggsewsaeeinkiqaffadkepedyrr
ykidgepfeekslhpvgliatnamgslasvdgpyakanvdlfwntpvrtgnrryydncly
lfamlalsgnfkiwfp

SCOPe Domain Coordinates for d2droa_:

Click to download the PDB-style file with coordinates for d2droa_.
(The format of our PDB-style files is described here.)

Timeline for d2droa_: