SCOPe 2.06: Domain d2drka1: 2drk A:6-59

Lineage for d2drka1 (2drk A:6-59)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Acanthamoeba castellanii [TaxId:5755] [187629] (1 PDB entry)

8. Domain d2drka1: 2drk A:6-59 [163663]
   Other proteins in same PDB: d2drka2
   automated match to d2semb_
   complexed with gol, so4

Details for d2drka1

PDB Entry: 2drk, 1.42 Å

PDB Description: Acanthamoeba myosin I SH3 domain bound to Acan125

PDB Compounds: (A:) Myosin heavy chain IB

SCOPe Domain Sequences for d2drka1:

Sequence; same for both SEQRES and ATOM records:

>d2drka1 b.34.2.0 (A:6-59) automated matches {Acanthamoeba castellanii [TaxId: 5755]}
qvkalydydaqtgdeltfkegdtiivhqkdpagwwegelngkrgwvpanyvqdi

Timeline for d2drka1:

• d2drka1 first appeared in SCOPe 2.01, called d2drka_
  
• d2drka1 was called d2drka_ in SCOPe 2.05
  
• d2drka1 appears in SCOPe 2.07
  
• d2drka1 appears in the current release, SCOPe 2.08