![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
![]() | Protein automated matches [190457] (10 species) not a true protein |
![]() | Species Acanthamoeba castellanii [TaxId:5755] [187629] (1 PDB entry) |
![]() | Domain d2drka1: 2drk A:6-59 [163663] Other proteins in same PDB: d2drka2 automated match to d2semb_ complexed with gol, so4 |
PDB Entry: 2drk (more details), 1.42 Å
SCOPe Domain Sequences for d2drka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2drka1 b.34.2.0 (A:6-59) automated matches {Acanthamoeba castellanii [TaxId: 5755]} qvkalydydaqtgdeltfkegdtiivhqkdpagwwegelngkrgwvpanyvqdi
Timeline for d2drka1: