Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
Protein automated matches [190457] (5 species) not a true protein |
Species Acanthamoeba castellanii [TaxId:5755] [187629] (1 PDB entry) |
Domain d2drka_: 2drk A: [163663] automated match to d2semb_ complexed with gol, so4 |
PDB Entry: 2drk (more details), 1.42 Å
SCOPe Domain Sequences for d2drka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2drka_ b.34.2.0 (A:) automated matches {Acanthamoeba castellanii [TaxId: 5755]} gspgiqvkalydydaqtgdeltfkegdtiivhqkdpagwwegelngkrgwvpanyvqdi
Timeline for d2drka_: