Lineage for d2drka_ (2drk A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946224Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 946580Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 946581Protein automated matches [190457] (5 species)
    not a true protein
  7. 946582Species Acanthamoeba castellanii [TaxId:5755] [187629] (1 PDB entry)
  8. 946583Domain d2drka_: 2drk A: [163663]
    automated match to d2semb_
    complexed with gol, so4

Details for d2drka_

PDB Entry: 2drk (more details), 1.42 Å

PDB Description: Acanthamoeba myosin I SH3 domain bound to Acan125
PDB Compounds: (A:) Myosin heavy chain IB

SCOPe Domain Sequences for d2drka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2drka_ b.34.2.0 (A:) automated matches {Acanthamoeba castellanii [TaxId: 5755]}
gspgiqvkalydydaqtgdeltfkegdtiivhqkdpagwwegelngkrgwvpanyvqdi

SCOPe Domain Coordinates for d2drka_:

Click to download the PDB-style file with coordinates for d2drka_.
(The format of our PDB-style files is described here.)

Timeline for d2drka_: