Lineage for d2drka1 (2drk A:6-59)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377019Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2377486Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2377487Protein automated matches [190457] (10 species)
    not a true protein
  7. 2377488Species Acanthamoeba castellanii [TaxId:5755] [187629] (1 PDB entry)
  8. 2377489Domain d2drka1: 2drk A:6-59 [163663]
    Other proteins in same PDB: d2drka2
    automated match to d2semb_
    complexed with gol, so4

Details for d2drka1

PDB Entry: 2drk (more details), 1.42 Å

PDB Description: Acanthamoeba myosin I SH3 domain bound to Acan125
PDB Compounds: (A:) Myosin heavy chain IB

SCOPe Domain Sequences for d2drka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2drka1 b.34.2.0 (A:6-59) automated matches {Acanthamoeba castellanii [TaxId: 5755]}
qvkalydydaqtgdeltfkegdtiivhqkdpagwwegelngkrgwvpanyvqdi

SCOPe Domain Coordinates for d2drka1:

Click to download the PDB-style file with coordinates for d2drka1.
(The format of our PDB-style files is described here.)

Timeline for d2drka1: