Lineage for d2drja_ (2drj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151564Fold c.130: Alpha-2,3/8-sialyltransferase CstII [102413] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 8 strands, order 54321678
  4. 2151565Superfamily c.130.1: Alpha-2,3/8-sialyltransferase CstII [102414] (2 families) (S)
  5. 2151566Family c.130.1.1: Alpha-2,3/8-sialyltransferase CstII [102415] (2 protein domains)
    automatically mapped to Pfam PF06002
  6. 2151567Protein Alpha-2,3/8-sialyltransferase CstII [102416] (1 species)
  7. 2151568Species Campylobacter jejuni [TaxId:197] [102417] (5 PDB entries)
  8. 2151579Domain d2drja_: 2drj A: [163662]
    automated match to d1ro8a_
    complexed with csf, ipa; mutant

Details for d2drja_

PDB Entry: 2drj (more details), 2.25 Å

PDB Description: xray structure of alpha-2,3/8-sialyltransferase cstii f91y mutant
PDB Compounds: (A:) Alpha-2,3/8-sialyltransferase

SCOPe Domain Sequences for d2drja_:

Sequence, based on SEQRES records: (download)

>d2drja_ c.130.1.1 (A:) Alpha-2,3/8-sialyltransferase CstII {Campylobacter jejuni [TaxId: 197]}
kkviiagngpslkeidysrlpndfdvfrcnqfyfedkyylgkkckavfynpslffeqyyt
lkhliqnqeyetelimcsnynqahlenenyvktfydyfpdahlgydffkqlkdfnayfkf
heiyfnqritsgvymcavaialgykeiylsgidfyqngssyafdtkqknllklapnfknd
nshyighskntdikaleflektykiklyclcpnsllanfiglapnlnsnfiiqeknnytk
dilipsseaygkfs

Sequence, based on observed residues (ATOM records): (download)

>d2drja_ c.130.1.1 (A:) Alpha-2,3/8-sialyltransferase CstII {Campylobacter jejuni [TaxId: 197]}
kkviiagngpslkeidysrlpndfdvfrcnqfyfedkyylgkkckavfynpslffeqyyt
lkhliqnqeyetelimcsnynqahlenenyvktfydyfpdahlgydffkqlkdfnayfkf
heiyfnqritsgvymcavaialgykeiylsgidfytkqknllklapnkntdikaleflek
tykiklyclcpnsllanfiglapnlnsnfiiqeknnytkdilipsseaygkfs

SCOPe Domain Coordinates for d2drja_:

Click to download the PDB-style file with coordinates for d2drja_.
(The format of our PDB-style files is described here.)

Timeline for d2drja_: