Lineage for d2abda_ (2abd A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310789Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2310790Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) (S)
  5. 2310791Family a.11.1.1: Acyl-CoA binding protein [47028] (2 proteins)
    automatically mapped to Pfam PF00887
  6. 2310792Protein Acyl-CoA binding protein [47029] (2 species)
  7. 2310793Species Cow (Bos taurus) [TaxId:9913] [47030] (6 PDB entries)
    Uniprot P07107
  8. 2310801Domain d2abda_: 2abd A: [16366]

Details for d2abda_

PDB Entry: 2abd (more details)

PDB Description: the three-dimensional structure of acyl-coenzyme a binding protein from bovine liver. structural refinement using heteronuclear multidimensional nmr spectroscopy
PDB Compounds: (A:) acyl-coenzyme a binding protein

SCOPe Domain Sequences for d2abda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2abda_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]}
sqaefdkaaeevkhlktkpadeemlfiyshykqatvgdinterpgmldfkgkakwdawne
lkgtskedamkayidkveelkkkygi

SCOPe Domain Coordinates for d2abda_:

Click to download the PDB-style file with coordinates for d2abda_.
(The format of our PDB-style files is described here.)

Timeline for d2abda_: