Lineage for d2abd__ (2abd -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) 
Superfamily a.11.1: Acyl-CoA binding protein [47027] (1 family) 
Family a.11.1.1: Acyl-CoA binding protein [47028] (1 protein) Protein Acyl-CoA binding protein [47029] (1 species) Species Cow (Bos taurus) [TaxId:9913] [47030] (2 PDB entries) 
Domain d2abd__: 2abd - [16366]
Details for d2abd__
PDB Entry: 2abd (more details)
PDB Description: the three-dimensional structure of acyl-coenzyme a binding protein from bovine liver. structural refinement using heteronuclear multidimensional nmr spectroscopy
SCOP Domain Sequences for d2abd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2abd__ a.11.1.1 (-) Acyl-CoA binding protein {Cow (Bos taurus)}
sqaefdkaaeevkhlktkpadeemlfiyshykqatvgdinterpgmldfkgkakwdawne
lkgtskedamkayidkveelkkkygi
SCOP Domain Coordinates for d2abd__:
Click to download the PDB-style file with coordinates for d2abd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2abd__:
- d2abd__ appears in SCOP 1.57
- d2abd__ appears in the current release, SCOPe 2.08, called d2abda_
View in 3D