SCOPe 2.08: Domain d2abda_: 2abd A:

Lineage for d2abda_ (2abd A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families)

5. Family a.11.1.1: Acyl-CoA binding protein [47028] (2 proteins)
   automatically mapped to Pfam PF00887

6. Protein Acyl-CoA binding protein [47029] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47030] (6 PDB entries)
   Uniprot P07107

8. Domain d2abda_: 2abd A: [16366]

Details for d2abda_

PDB Entry: 2abd

PDB Description: the three-dimensional structure of acyl-coenzyme a binding protein from bovine liver. structural refinement using heteronuclear multidimensional nmr spectroscopy

PDB Compounds: (A:) acyl-coenzyme a binding protein

SCOPe Domain Sequences for d2abda_:

Sequence; same for both SEQRES and ATOM records:

>d2abda_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]}
sqaefdkaaeevkhlktkpadeemlfiyshykqatvgdinterpgmldfkgkakwdawne
lkgtskedamkayidkveelkkkygi

Timeline for d2abda_:

• d2abda_ first appeared (with stable ids) in SCOP 1.55, called d2abd__
  
• d2abda_ appears in SCOPe 2.07