Class a: All alpha proteins [46456] (290 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) |
Family a.11.1.1: Acyl-CoA binding protein [47028] (2 proteins) automatically mapped to Pfam PF00887 |
Protein Acyl-CoA binding protein [47029] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [47030] (6 PDB entries) Uniprot P07107 |
Domain d2abda_: 2abd A: [16366] |
PDB Entry: 2abd (more details)
SCOPe Domain Sequences for d2abda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2abda_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} sqaefdkaaeevkhlktkpadeemlfiyshykqatvgdinterpgmldfkgkakwdawne lkgtskedamkayidkveelkkkygi
Timeline for d2abda_: