SCOPe 2.08: Domain d2dpxb_: 2dpx B:

Lineage for d2dpxb_ (2dpx B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d2dpxb_: 2dpx B: [163656]
   automated match to d2gjsa1
   complexed with gdp, mg

Details for d2dpxb_

PDB Entry: 2dpx, 1.8 Å

PDB Description: Crystal Structure of human Rad GTPase

PDB Compounds: (B:) GTP-binding protein RAD

SCOPe Domain Sequences for d2dpxb_:

Sequence, based on SEQRES records:

>d2dpxb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ykvlllgapgvgksalarifggvedgpeaeaaghtydrsivvdgeeaslmvydiweqdgg
rwlpghcmamgdayvivysvtdkgsfekaselrvqlrrarqtddvpiilvgnksdlvrsr
evsvdegracavvfdckfietsaalhhnvqalfegvvrqirlr

Sequence, based on observed residues (ATOM records):

>d2dpxb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ykvlllgapgvgksalarifggvehtydrsivvdgeeaslmvydiwmgdayvivysvtdk
gsfekaselrvqlrravpiilvgnksdlvrsrevsvdegracavvfdckfietsaalhhn
vqalfegvvrqirlr

Timeline for d2dpxb_:

• d2dpxb_ first appeared in SCOPe 2.01
  
• d2dpxb_ appears in SCOPe 2.07