Lineage for d2dppa_ (2dpp A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548277Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 2548278Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 2548279Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 2548299Protein automated matches [190256] (6 species)
    not a true protein
  7. 2548302Species Bacillus sp. [TaxId:218609] [187626] (1 PDB entry)
  8. 2548303Domain d2dppa_: 2dpp A: [163653]
    Other proteins in same PDB: d2dppb_
    automated match to d1v29a_
    complexed with co

Details for d2dppa_

PDB Entry: 2dpp (more details), 2.52 Å

PDB Description: Crystal structure of thermostable Bacillus sp. RAPc8 nitrile hydratase
PDB Compounds: (A:) Nitrile hydratase alpha subunit

SCOPe Domain Sequences for d2dppa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dppa_ d.149.1.1 (A:) automated matches {Bacillus sp. [TaxId: 218609]}
idprfphhhprpqsfwearakaleslliekghlssdaiervikhyehelgpmngakvvak
awtdpafkqrlledsetvlrelgyyglqgehirvventdtvhnvvvctlcscypwpllgl
ppswykepayrarvvkeprqvlkefgldlpdsveirvwdssseirfmvlpqrpegtegmt
eeelaklvtrdsmigvakiepp

SCOPe Domain Coordinates for d2dppa_:

Click to download the PDB-style file with coordinates for d2dppa_.
(The format of our PDB-style files is described here.)

Timeline for d2dppa_: