![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
![]() | Protein automated matches [190068] (12 species) not a true protein |
![]() | Species Streptomyces coelicolor [TaxId:100226] [187338] (8 PDB entries) |
![]() | Domain d2dkka1: 2dkk A:13-407 [163646] Other proteins in same PDB: d2dkka2 automated match to d1s1fa_ complexed with hem, imd |
PDB Entry: 2dkk (more details), 1.97 Å
SCOPe Domain Sequences for d2dkka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dkka1 a.104.1.1 (A:13-407) automated matches {Streptomyces coelicolor [TaxId: 100226]} pppvrdwpaldldgpefdpvlaelmregpltrvrlphgegwawlatryddvkaitndprf graevtqrqitrlaphfkprpgslafadqpdhnrlrravagaftvgatkrlrpraqeild glvdgilaegppadlvervlepfpiavvsevmgvpaadrervhswtrqiistsggaeaae rakrglygwitetvraragseggdvysmlgaavgrgevgeteavglagplqiggeavthn vgqmlyllltrrelmarmrerpgargtaldellrwishrtsvglarialedvevhgtria agepvyvsylaanrdpdvfpdpdridldrdpnphlaygnghhfctgavlarmqtellvdt llerlpglrlavpaeqvawrrktmirgprtlpctw
Timeline for d2dkka1: