SCOPe 2.06: Domain d2dkjb_: 2dkj B:

Lineage for d2dkjb_ (2dkj B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein automated matches [190152] (22 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187623] (1 PDB entry)

8. Domain d2dkjb_: 2dkj B: [163645]
   automated match to d1kkja_
   complexed with plp, so4

Details for d2dkjb_

PDB Entry: 2dkj, 1.15 Å

PDB Description: Crystal Structure of T.th.HB8 Serine Hydroxymethyltransferase

PDB Compounds: (B:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d2dkjb_:

Sequence; same for both SEQRES and ATOM records:

>d2dkjb_ c.67.1.4 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
krdealfelialeekrqregleliasenfvskqvreavgsvltnkyaegypgaryyggce
vidrveslaierakalfgaawanvqphsgsqanmavymalmepgdtlmgmdlaagghlth
gsrvnfsgklykvvsygvrpdtelidleevrrlalehrpkvivagasayprfwdfkafre
iadevgaylvvdmahfaglvaaglhpnplpyahvvtstthktlrgprgglilsndpelgk
ridklifpgiqggplehviagkavaffealqpefkeysrlvvenakrlaeelarrgyriv
tggtdnhlflvdlrpkgltgkeaeerldavgitvnknaipfdpkpprvtsgirigtpait
trgftpeemplvaelidrallegpsealreevrrlalahpmp

Timeline for d2dkjb_:

• d2dkjb_ first appeared in SCOPe 2.01
  
• d2dkjb_ appears in SCOPe 2.05
  
• d2dkjb_ appears in SCOPe 2.07
  
• d2dkjb_ appears in the current release, SCOPe 2.08