Lineage for d2dkjb_ (2dkj B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131998Protein automated matches [190152] (22 species)
    not a true protein
  7. 2132089Species Thermus thermophilus HB8 [TaxId:300852] [187623] (1 PDB entry)
  8. 2132091Domain d2dkjb_: 2dkj B: [163645]
    automated match to d1kkja_
    complexed with plp, so4

Details for d2dkjb_

PDB Entry: 2dkj (more details), 1.15 Å

PDB Description: Crystal Structure of T.th.HB8 Serine Hydroxymethyltransferase
PDB Compounds: (B:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d2dkjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dkjb_ c.67.1.4 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
krdealfelialeekrqregleliasenfvskqvreavgsvltnkyaegypgaryyggce
vidrveslaierakalfgaawanvqphsgsqanmavymalmepgdtlmgmdlaagghlth
gsrvnfsgklykvvsygvrpdtelidleevrrlalehrpkvivagasayprfwdfkafre
iadevgaylvvdmahfaglvaaglhpnplpyahvvtstthktlrgprgglilsndpelgk
ridklifpgiqggplehviagkavaffealqpefkeysrlvvenakrlaeelarrgyriv
tggtdnhlflvdlrpkgltgkeaeerldavgitvnknaipfdpkpprvtsgirigtpait
trgftpeemplvaelidrallegpsealreevrrlalahpmp

SCOPe Domain Coordinates for d2dkjb_:

Click to download the PDB-style file with coordinates for d2dkjb_.
(The format of our PDB-style files is described here.)

Timeline for d2dkjb_: